PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 315aa    MW: 36067.3 Da    PI: 5.2383
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007371genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.45.7e-161050242
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                  i+n++nr+ t+ kR++ +lKK eE S+LC++e+++i+f +
  Lus10007371 10 LIKNERNRSNTYKKRKANLLKKMEEFSILCGVEACLIVFQP 50
                 59************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.6E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.708148IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-19299IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-9323IPR002100Transcription factor, MADS-box
CDDcd002661.41E-19492No hitNo description
PfamPF003192.3E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGHKRVKMEL IKNERNRSNT YKKRKANLLK KMEEFSILCG VEACLIVFQP PNLTEDGADQ  60
LQTWPPDRDS VAATIQRYRT SEGPKRCYHL SDYFSEKKKR VGVELSKINK LIYSRKFPTW  120
DARIDRFSAD QLKTLLGQLD SEIETADQKL ESFNQILDHD QFLVPVRNFE QFGLASDYYG  180
NGFQQVYCND QSLQFGHDQS SFMAMLNPNY FSSLYWDQVN NFGYYDDPSL NNLDNIGTEL  240
ILSPENLSTI NFEPFGHHHL ANQPDSQMVA AKVENETRRF GVYGGGEQSM VTSSYDSSSM  300
EFGECGMMSY INSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-26M-type_MADS family protein